SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A227LIU5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A227LIU5
Domain Number - Region: 19-58
Classification Level Classification E-value
Superfamily PsbU/PolX domain-like 0.0229
Family DNA polymerase beta-like, second domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A227LIU5
Sequence length 77
Comment (tr|A0A227LIU5|A0A227LIU5_9FIRM) Uncharacterized protein {ECO:0000313|EMBL:OXE66395.1} KW=Complete proteome OX=1531 OS=[Clostridium] clostridioforme. GN=ADH76_20795 OC=Bacteria; Firmicutes; Clostridia; Clostridiales; Lachnospiraceae.
Sequence
MAKEEKGTGAETAAEPAVPVYETIEHWYNVHGTGPAVYAGTLCLKGWRPGKQVTEQEYLA
AVTAFEKGPMAGTGGTR
Download sequence
Identical sequences A0A0E2H1U9 A0A1C7G4N4 A0A227LIU5 R0B205
WP_002584813.1.17088 WP_002584813.1.26516 WP_002584813.1.46131 WP_002584813.1.67049

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]