SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A229QYG1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A229QYG1
Domain Number 1 Region: 24-155
Classification Level Classification E-value
Superfamily Ecotin, trypsin inhibitor 2.09e-49
Family Ecotin, trypsin inhibitor 0.0000283
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A229QYG1
Sequence length 157
Comment (tr|A0A229QYG1|A0A229QYG1_9PSED) Ecotin {ECO:0000313|EMBL:OXM39530.1} OX=1793966 OS=Pseudomonas fluvialis. GN=CFY91_12870 OC=Pseudomonadaceae; Pseudomonas.
Sequence
MLNRPLPLLIMACCLPLSACATTAETLSVYPSTLPGLQRHVIDLPAKDTESDYQVELIAG
KTLQIDCNQQRLSGQWQQQTVQGWGYDYYVLQNVGPGISTLMACPEQEPQEAFVQVAGEP
VMLRYNSKLPLVIFAPQDVEIRYRLWSAGPTWPAASQ
Download sequence
Identical sequences A0A229QYG1
WP_093986780.1.56116

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]