SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A229RNZ2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A229RNZ2
Domain Number 1 Region: 16-155
Classification Level Classification E-value
Superfamily BH3703-like 1.18e-18
Family BH3703-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A229RNZ2
Sequence length 157
Comment (tr|A0A229RNZ2|A0A229RNZ2_9PSEU) Uncharacterized protein {ECO:0000313|EMBL:OXM48392.1} KW=Complete proteome OX=589330 OS=Amycolatopsis thailandensis. GN=CFP71_33265 OC=Amycolatopsis.
Sequence
MTTTTHSGPVTSGGESHEDLIQQLGTALLNLVPVEGWRRIDLVSAMTVPAQDLGLTVIMD
DGSRPEIAPPHELNVILAKLRTLLYQRGRGTWFSARISMNPPGAIFYNYNNDYEPVLTPP
MEPEHYVEDLKMFPRDPDHIPAWLGEKLAAAEDKERN
Download sequence
Identical sequences A0A229RNZ2
WP_093937898.1.80055

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]