SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A231MKJ3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A231MKJ3
Domain Number 1 Region: 1-87
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.06e-22
Family Ubiquitin-related 0.00039
Further Details:      
 
Domain Number 2 Region: 261-326
Classification Level Classification E-value
Superfamily XPC-binding domain 7.19e-20
Family XPC-binding domain 0.00039
Further Details:      
 
Domain Number 3 Region: 322-380
Classification Level Classification E-value
Superfamily UBA-like 5.39e-16
Family UBA domain 0.0015
Further Details:      
 
Domain Number 4 Region: 136-194
Classification Level Classification E-value
Superfamily UBA-like 0.00000000000224
Family UBA domain 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A231MKJ3
Sequence length 382
Comment (tr|A0A231MKJ3|A0A231MKJ3_9EURO) Uncharacterized protein {ECO:0000313|EMBL:OXS10744.1} KW=Complete proteome; Reference proteome OX=41047 OS=Aspergillus thermomutatus. GN=CDV56_04415 OC=Eurotiomycetidae; Eurotiales; Aspergillaceae; Aspergillus.
Sequence
MKLTFKDLKQQKFVIDAEPSETVGEVKEKISKEKGWEVPQLKLIYSGKILQDDKTIETYN
IEEKGFIVCMVSKPKAPSSAATPSQAPVTPSRAAASTPAAPAAPAAPAPSAAPSAPSAPA
VPATPSPAAPAQAPADASSAFNDPSALLSGSQSEAVITQMESMGFPRSDINRAMRAAFFN
PDRAIEYLLNGIPDNIQQEQQQQAAAAAAPPAPSAPSGESAPSSTGGDEPVNLFEAAAQA
GTGEGAGRGARAAAGGAGEGLPNLDFLRNNPHFQQLRQLVQQQPQMLEPILQQVAAGNPQ
IAQLIGQNEEQFLQLLSEEDDGALPPGTHAISVTEEERDAIERLCRLGFSRDLVIQAYFA
CDKNEELAANYLFENPDDPDDL
Download sequence
Identical sequences A0A231MKJ3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]