SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A231MPC2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A231MPC2
Domain Number 1 Region: 88-180
Classification Level Classification E-value
Superfamily TATA-box binding protein-like 3.14e-34
Family TATA-box binding protein (TBP), C-terminal domain 0.0000041
Further Details:      
 
Domain Number 2 Region: 172-262
Classification Level Classification E-value
Superfamily TATA-box binding protein-like 2.83e-31
Family TATA-box binding protein (TBP), C-terminal domain 0.00000944
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A231MPC2
Sequence length 264
Comment (tr|A0A231MPC2|A0A231MPC2_9EURO) Uncharacterized protein {ECO:0000313|EMBL:OXS12088.1} KW=Complete proteome; Reference proteome OX=41047 OS=Aspergillus thermomutatus. GN=CDV56_02644 OC=Eurotiomycetidae; Eurotiales; Aspergillaceae; Aspergillus.
Sequence
MESLTTHPSTAQQARAFTSPASLSFPGGAGDLTPPSSEKEGNMAIGAQGANGTVNGHQQG
GNAVNGNGVTPATPAATPGANAPGSGIVPTLQNIVATVNLDCRLDLKTIALHARNAEYNP
KRFAAVIMRIREPKTTALIFASGKMVVTGAKSEDDSKLASRKYARIIQKLGFNAKFTDFK
IQNIVGSCDIKFPIRLEGLASRHHNFSSYEPELFPGLIYRMMKPKIVLLIFVSGKIVLTG
AKVREEIYQAFELIYPVLSDFRKV
Download sequence
Identical sequences A0A0K8LAD7 A0A229X538 A0A231MPC2 A1D756
36630.CADNFIAP00006132 NFIA_067170||RNA XP_001263447.1.95823

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]