SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A233SG33 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A233SG33
Domain Number 1 Region: 31-168
Classification Level Classification E-value
Superfamily AbfB domain 0.000000000000719
Family AbfB domain 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A233SG33
Sequence length 171
Comment (tr|A0A233SG33|A0A233SG33_9ACTN) Uncharacterized protein {ECO:0000313|EMBL:OXY94606.1} KW=Complete proteome; Reference proteome OX=42236 OS=Streptomyces diastatochromogenes. GN=BEK98_18620 OC=Streptomyces.
Sequence
MSGASSFPQDVISPRGLQCDRRREDMTRIQTFNMDQKFFVRHHNFEGEINELDFPGPIGD
FDWLVHFLRVDQGSRLLAFEAKHPSGFFLRHKNFRIVLEPPDGTELFKQDHAFREVAPLA
GDPRDGWHSYQAFQDKFKTRFLAHENLHLFLRDKSESGIAAGDASFRLIET
Download sequence
Identical sequences A0A233SG33
WP_094217770.1.26550

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]