SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A235X8H2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A235X8H2
Domain Number - Region: 33-84
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0085
Family Pseudo ankyrin repeat 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A235X8H2
Sequence length 89
Comment (tr|A0A235X8H2|A0A235X8H2_SHISO) Uncharacterized protein {ECO:0000313|EMBL:OYF65784.1} KW=Complete proteome OX=624 OS=Shigella sonnei. GN=CI641_19400 OC=Enterobacteriaceae; Shigella.
Sequence
MNNIKMITLFHPLEKTPFMVCIINKVEDTELGLKLTLENGNNICVNNYSHYLLSESVSRC
DKDRLKNIYIRLVSELTQMSEETIKSQML
Download sequence
Identical sequences A0A1X0YS35 A0A235X8H2 U9XW24
WP_023155934.1.101096 WP_023155934.1.19557 WP_023155934.1.30452 WP_023155934.1.36610 WP_023155934.1.49722 WP_023155934.1.63177 WP_023155934.1.67026 WP_023155934.1.71987 WP_023155934.1.88997 WP_023155934.1.90270

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]