SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A238FEA5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A238FEA5
Domain Number 1 Region: 243-389
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.13e-29
Family cAMP-binding domain 0.0000464
Further Details:      
 
Domain Number 2 Region: 383-516
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 3.93e-24
Family cAMP-binding domain 0.00021
Further Details:      
 
Domain Number 3 Region: 3-40
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00000418
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A238FEA5
Sequence length 556
Comment (tr|A0A238FEA5|A0A238FEA5_9BASI) BQ2448_4846 protein {ECO:0000313|EMBL:SCV72152.1} KW=Complete proteome; Reference proteome OX=269621 OS=Microbotryum intermedium. GN=BQ2448_4846 OC=Microbotryomycetes; Microbotryales; Microbotryaceae; Microbotryum.
Sequence
MSLPASYSSILSDLNRDVLRAQPTDALQFCANWFQTRLEQERSLARSTVSSSASSNGAAS
MPSAASAVASSRSSGQLAPSVSLRNRQVTPPSLVGQGYTFGGARGMDLEGDNKPSPFSEI
PPVVPGAGGSSHIDRPGSNPPSPFSKVGERGLNSSSSSTPSTFHPAPLTFDGSALSSSMT
AKRGSLASNDSDDDDVYDPRDTSSGSGDGTLGIPVNYNLGRRSSVSAESLNPDPAAPMPK
TVIPKSESQRQRIEASIANNLLFRNLDEEQHNDVLNAMKEVKVQDKTSVIVQGAVGDFFY
VVEEGSFEAWVRSPPTHSYNGPGSSTMTQGEEKKVASYGPGGAFGELALMYNAPRAASVV
ATSDAVVWALDRVTFRSILMEHTSRKRKMYESFLAEVPILLSLNPKERAKIVDALEAKVY
EEGEPVVVEGEVGKNFYIIESGKAEVTKRRKSPSSGTFNDDVLGTLSKGDYFGELALLNS
APRAATVRAMAGQGRLRVATLGEKAFTRLLGPVLDILQRKAEHSYGPGATTGQHSQHDSF
SATLGESRVQTPGITA
Download sequence
Identical sequences A0A238FEA5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]