SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A238FL72 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A238FL72
Domain Number 1 Region: 32-122
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.00000209
Family Pseudo ankyrin repeat 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A238FL72
Sequence length 177
Comment (tr|A0A238FL72|A0A238FL72_9BASI) BQ2448_4520 protein {ECO:0000313|EMBL:SCV71826.1} KW=Complete proteome; Reference proteome OX=269621 OS=Microbotryum intermedium. GN=BQ2448_4520 OC=Microbotryomycetes; Microbotryales; Microbotryaceae; Microbotryum.
Sequence
MPPTAYTEAALLSATIQRQKASLEWWRNSGLDLKIGPVLDYASKEGTLEYLDWWANSGLP
CPYSKAALRYISQMGNIALLDWWKHSRFKMDYDKDVILIATRYGQTRSLSWWLESGLDVE
YRFFDIEEALEDSVTGKDESQKWWEALGYDVGMSQTEWTRVRNFRVQRKELTAGGRN
Download sequence
Identical sequences A0A238FL72

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]