SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A239G3H9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A239G3H9
Domain Number 1 Region: 9-153
Classification Level Classification E-value
Superfamily LigT-like 0.0000000000863
Family tRNA splicing product Appr>p cyclic nucleotide phosphodiesterase 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A239G3H9
Sequence length 169
Comment (tr|A0A239G3H9|A0A239G3H9_9ACTN) 2'-5' RNA ligase superfamily protein {ECO:0000313|EMBL:SNS63640.1} KW=Complete proteome; Reference proteome OX=52697 OS=Actinoplanes regularis. GN=SAMN06264365_1207 OC=Actinoplanes.
Sequence
MVAALELYLDVDATRRVRTLWRALDSEGIPTLGSLHQKHRPHVSLAAARTIDPHLAAAAL
EGLVVGRGLTLRLDFAGQFVGRVLWLGVTMTPELMEHHRSVHERLSAGGVEVWEHYRPGL
WVPHCTVSLRVPNPMMAPAIRRCLEILPLTATVTGAAIADHANDIAHPL
Download sequence
Identical sequences A0A239G3H9
WP_089297566.1.84645

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]