SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A241XQE5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A241XQE5
Domain Number 1 Region: 248-313
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.000000068
Family Pseudo ankyrin repeat 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A241XQE5
Sequence length 417
Comment (tr|A0A241XQE5|A0A241XQE5_PSEAI) SMI1/KNR4 family protein {ECO:0000313|EMBL:OTI61723.1} KW=Complete proteome OX=287 OS=Pseudomonas aeruginosa. GN=CAZ10_13545 OC=Pseudomonadaceae; Pseudomonas.
Sequence
MELSPAERQLLLAHRLAVFDGCVVYDAQPPVSAEHVQRLAEGLAGPIPEDLLRLWRTCFG
GRLGYDLEVDYDGHRHPFSFSELFYPDSDGYHDLWGWIEHERELAAEAAAEEGRDWNGKL
AYLPFGGFEYLERLYVCVEPGPEHGAVIAWSHGLPPAWAGRLHQDSVTRLADDVGGLFRL
LSFEQDPFDAENACGVADELLEALDALEAAGEPGKALKGRLEVLLRQRILDWRPALADGS
LAAEPRLRQLALAEAAQDGDIDLLQRLRDAGCDFAETLRGRGGVLEACLARGRLEAARWL
LDQGVAVHQDSLQIGAAHLDAVLAERLLRLGAISDPNTVLLALQYGDADAARIMARPLLE
ESPTRASALRLALASRAERERSDARRVRSGKMGSNRSPDDYLALAERLERFLAELPG
Download sequence
Identical sequences A0A241XQE5
WP_023118541.1.100473 WP_023118541.1.11754 WP_023118541.1.14378 WP_023118541.1.15231 WP_023118541.1.15886 WP_023118541.1.17155 WP_023118541.1.18735 WP_023118541.1.20682 WP_023118541.1.21871 WP_023118541.1.21891 WP_023118541.1.221 WP_023118541.1.22477 WP_023118541.1.22573 WP_023118541.1.23013 WP_023118541.1.24087 WP_023118541.1.2453 WP_023118541.1.24938 WP_023118541.1.26816 WP_023118541.1.27211 WP_023118541.1.27259 WP_023118541.1.29137 WP_023118541.1.33340 WP_023118541.1.34878 WP_023118541.1.35149 WP_023118541.1.35762 WP_023118541.1.35984 WP_023118541.1.42508 WP_023118541.1.42854 WP_023118541.1.43356 WP_023118541.1.45358 WP_023118541.1.47930 WP_023118541.1.48382 WP_023118541.1.49293 WP_023118541.1.49988 WP_023118541.1.53169 WP_023118541.1.53663 WP_023118541.1.55400 WP_023118541.1.56187 WP_023118541.1.56442 WP_023118541.1.61431 WP_023118541.1.63659 WP_023118541.1.64603 WP_023118541.1.65247 WP_023118541.1.65867 WP_023118541.1.70098 WP_023118541.1.73172 WP_023118541.1.7456 WP_023118541.1.76322 WP_023118541.1.76383 WP_023118541.1.78134 WP_023118541.1.79256 WP_023118541.1.79908 WP_023118541.1.8028 WP_023118541.1.80880 WP_023118541.1.81728 WP_023118541.1.81957 WP_023118541.1.81960 WP_023118541.1.83698 WP_023118541.1.84937 WP_023118541.1.87547 WP_023118541.1.87970 WP_023118541.1.89434 WP_023118541.1.89776 WP_023118541.1.9272 WP_023118541.1.98960

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]