SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A243CYB4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A243CYB4
Domain Number - Region: 437-464
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0157
Family Pseudo ankyrin repeat 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A243CYB4
Sequence length 488
Comment (tr|A0A243CYB4|A0A243CYB4_BACTU) UPF0061 protein BK749_10135 {ECO:0000256|HAMAP-Rule:MF_00692} KW=Complete proteome OX=180867 OS=Bacillus thuringiensis serovar vazensis. GN=BK749_10135 OC=Bacillus cereus group.
Sequence
MTKNNEVGWNLDNSYATLPQSFYTEIPPTPVSSPELVKLNHSLAISLGFNPEELKKEAEI
AIFAGNALPEGAHPLAQAYAGHQFGHFNMLGDGRALLIGEQITPSGKRFDIQLKGSGPTP
YSRRGDGRAALGPMLREYIISEAMYALDIPTTRSLAVVTTGEPTYRETKLPGAILTRVAS
SHIRVGTFQYAAARGSIEDLQSLADYTIKRHYPEIEAHENRYTALLQEVIKKQASLIAKW
QLVGFIHGVMNTDNITISGETIDYGPCAFMDNYDQGTVFSSIDTQGRYAYGNQPYMAAWD
LARLAESLIPILHEDEEEALKIAQDEISKFSVQYENQWFLGMKRKLGLFSNDEQDQSLIE
QLLKMMEKFKADYTNTFRSLTLNTIENTALFESPEFKEWYKLWQSRLERQEESKENAYEM
MKNNNPSIIPRNHRVEEALEAAVANGDYSVMEKLLEALANPYAYSTDQEEYCVPPAPTNR
PYRTFCGT
Download sequence
Identical sequences A0A243CYB4
WP_000164937.1.100409 WP_000164937.1.63611

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]