SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A243DCF6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A243DCF6
Domain Number - Region: 15-65
Classification Level Classification E-value
Superfamily Rap30/74 interaction domains 0.0863
Family Rap30/74 interaction domains 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A243DCF6
Sequence length 92
Comment (tr|A0A243DCF6|A0A243DCF6_BACTU) Uncharacterized protein {ECO:0000313|EMBL:OTY94713.1} KW=Complete proteome OX=475791 OS=Bacillus thuringiensis serovar subtoxicus. GN=BK754_15455 OC=Bacillus cereus group.
Sequence
MDKYDPSKHYHIGYYEDGYDLEVTAYKRINEPVWDAYLPHYEADDFYKKVEEMKLGEYID
DYGIKVYSFSDDINDEEARTIFEKWLKKNEIV
Download sequence
Identical sequences A0A243DCF6 A0A2A7FD30 R8UD45
WP_016122203.1.100082 WP_016122203.1.10584 WP_016122203.1.23652 WP_016122203.1.3798 WP_016122203.1.73594 WP_016122203.1.85348 WP_016122203.1.86619 WP_016122203.1.90352 WP_016122203.1.99212

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]