SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A243DLP4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A243DLP4
Domain Number - Region: 49-79
Classification Level Classification E-value
Superfamily Hormone receptor domain 0.0837
Family Hormone receptor domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A243DLP4
Sequence length 89
Comment (tr|A0A243DLP4|A0A243DLP4_BACUD) Uncharacterized protein {ECO:0000313|EMBL:OTZ29059.1} KW=Complete proteome OX=132264 OS=Bacillus thuringiensis subsp. darmstadiensis. GN=BK761_03515 OC=Bacillus cereus group.
Sequence
MELVVSKENLKRLVSMKVEEIKNTFFDEIEEIKSTEIIDENGETIFFIYVYDDTNSMTSI
KCDKRGWEAQWGNYTPVYVKMTIEWIMCH
Download sequence
Identical sequences A0A243DLP4
WP_013141879.1.41518 WP_013141879.1.71114 gi|296502330|ref|YP_003664030.1| gi|296505538|ref|YP_003667238.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]