SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A243J0E3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A243J0E3
Domain Number - Region: 22-82
Classification Level Classification E-value
Superfamily N-terminal domain of adenylylcyclase associated protein, CAP 0.000994
Family N-terminal domain of adenylylcyclase associated protein, CAP 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A243J0E3
Sequence length 87
Comment (tr|A0A243J0E3|A0A243J0E3_BACTU) Uncharacterized protein {ECO:0000313|EMBL:OUB17153.1} KW=Complete proteome OX=143794 OS=Bacillus thuringiensis serovar yunnanensis. GN=BK708_22325 OC=Bacillus cereus group.
Sequence
MPYHKDKQQAFQAAQQGVTQAEHAYNNIVKNDPNYGHDLKELRQEVQEAYEQIQNALEVA
SETQRPQLEQYENNLQNIMQHVDQLEK
Download sequence
Identical sequences A0A023P8Z9 A0A0K0SBN1 A0A150CMH4 A0A242Z917 A0A243FEI9 A0A243J0E3 A0A243J5K8 A0A2B4EGI5 B5UKU6 C2N477 C2P1X2 G9Q3K2 J7Z373 W8YEL0
WP_001146293.1.101224 WP_001146293.1.10745 WP_001146293.1.26483 WP_001146293.1.31221 WP_001146293.1.3180 WP_001146293.1.35694 WP_001146293.1.42485 WP_001146293.1.43442 WP_001146293.1.44348 WP_001146293.1.44428 WP_001146293.1.47000 WP_001146293.1.47437 WP_001146293.1.51681 WP_001146293.1.54142 WP_001146293.1.61243 WP_001146293.1.62770 WP_001146293.1.6816 WP_001146293.1.71242 WP_001146293.1.72484 WP_001146293.1.74863 WP_001146293.1.75866 WP_001146293.1.77567 WP_001146293.1.869 WP_001146293.1.90466 WP_001146293.1.94308 WP_001146293.1.97082 WP_001146293.1.97561 WP_001146293.1.99636

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]