SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A243NZN3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A243NZN3
Domain Number 1 Region: 9-40
Classification Level Classification E-value
Superfamily Delta-sleep-inducing peptide immunoreactive peptide 0.0000379
Family Delta-sleep-inducing peptide immunoreactive peptide 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A243NZN3
Sequence length 75
Comment (tr|A0A243NZN3|A0A243NZN3_BACTV) Uncharacterized protein {ECO:0000313|EMBL:OUC03253.1} KW=Complete proteome OX=79672 OS=Bacillus thuringiensis subsp. medellin. GN=BK784_04530 OC=Bacillus cereus group.
Sequence
MNLEKEKPVNEEVAELKELIKELHGSVHQLQSEVQQLRHERPVVEVRKGVQLSPTIVGQI
GGMILGGLAIIGIFW
Download sequence
Identical sequences A0A164S3A3 A0A243HPM5 A0A243NZN3 A0A2A7GV64
WP_017673084.1.2251 WP_017673084.1.26513 WP_017673084.1.45317 WP_017673084.1.54736 WP_017673084.1.64568 WP_017673084.1.7593 WP_017673084.1.76902

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]