SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A243PXB6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A243PXB6
Domain Number - Region: 38-67
Classification Level Classification E-value
Superfamily Dimerization motif of sir4 0.0112
Family Dimerization motif of sir4 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A243PXB6
Sequence length 103
Comment (tr|A0A243PXB6|A0A243PXB6_LACPA) Gar-IM {ECO:0000313|EMBL:PLC47189.1} KW=Complete proteome OX=1597 OS=Lactobacillus paracasei. GN=BWK52_1483c OC=Lactobacillus.
Sequence
MVRGKAEIDDQTILSNLYDFVLNPDISDRERKIGLMAKADLEKKRYDVAVVNQVIVSLQQ
EAMKNGLTPIASKFYDDLEPILIKIKPFGTNLGNMLTHNSYLD
Download sequence
Identical sequences A0A0E2BV67 A0A158SH97 A0A1F1JJV7 A0A243PXB6 K0N4C3 K6R2J8 S2SU66
gi|409995708|ref|YP_006750109.1| WP_003577240.1.13158 WP_003577240.1.13224 WP_003577240.1.16871 WP_003577240.1.22898 WP_003577240.1.24722 WP_003577240.1.25220 WP_003577240.1.29319 WP_003577240.1.33776 WP_003577240.1.39141 WP_003577240.1.40478 WP_003577240.1.44079 WP_003577240.1.44847 WP_003577240.1.44983 WP_003577240.1.45488 WP_003577240.1.45928 WP_003577240.1.505 WP_003577240.1.61849 WP_003577240.1.62572 WP_003577240.1.63838 WP_003577240.1.65183 WP_003577240.1.67371 WP_003577240.1.6844 WP_003577240.1.7209 WP_003577240.1.73866 WP_003577240.1.74597 WP_003577240.1.80634 WP_003577240.1.86624 WP_003577240.1.88086 WP_003577240.1.91063 WP_003577240.1.98013 WP_003577240.1.98897 gi|385821741|ref|YP_005858083.1| gi|385818577|ref|YP_005854964.1| 543734.LCABL_00410 gi|191636865|ref|YP_001986031.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]