SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A249D300 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A249D300
Domain Number 1 Region: 4-164
Classification Level Classification E-value
Superfamily Heme iron utilization protein-like 8.63e-54
Family ChuX-like 0.00088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A249D300
Sequence length 170
Comment (tr|A0A249D300|A0A249D300_9GAMM) HuvX protein {ECO:0000313|EMBL:PHS89727.1} KW=Complete proteome OX=196024 OS=Aeromonas dhakensis. GN=AAW03_01610 OC=Aeromonadaceae; Aeromonas.
Sequence
MSIAQRIHGLLAQDPGAHPSTIAAELAVSEWEVVRHLPAELVTLVPAEQAEALLADLADW
GQVTTIVESDGSIFEVKAPFPRGKSARGYYNLMGRDGEMHGHLKLDNVVGIALVSKLFMG
KEGHSFQFFGHSGRCIFKVYLGRDEQRQLLPAQVERFMALRHQYQEEVKA
Download sequence
Identical sequences A0A249D300 K1JLD9
WP_005304096.1.11394 WP_005304096.1.12326 WP_005304096.1.16146 WP_005304096.1.26014 WP_005304096.1.31532 WP_005304096.1.3157 WP_005304096.1.32895 WP_005304096.1.43483 WP_005304096.1.45454 WP_005304096.1.48145 WP_005304096.1.51461 WP_005304096.1.51574 WP_005304096.1.96790 WP_005304096.1.99242

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]