SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A250FGU4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A250FGU4
Domain Number 1 Region: 311-450
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.06e-22
Family Glutathione peroxidase-like 0.0036
Further Details:      
 
Weak hits

Sequence:  A0A250FGU4
Domain Number - Region: 76-201,271-301
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0445
Family Pseudo ankyrin repeat 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A250FGU4
Sequence length 454
Comment (tr|A0A250FGU4|A0A250FGU4_CAPSP) Thiol-disulfide isomerase {ECO:0000313|EMBL:ATA84342.1} KW=Complete proteome OX=1019 OS=Capnocytophaga sputigena. GN=CGC55_07400 OC=Flavobacteriaceae; Capnocytophaga.
Sequence
MKKIITTLTTLVLLAPCGAQSLQKGKDYGVISGKLDFSMPNQKMRLIHNDKLFKEIAVGN
DGSFRDTIPVINNDHTYYLEDPISLSLYIDNKTNIEIFMSMQPFKVTVSGAQAEQTQYLI
ERDHFFKEKISDAYNTLFLQEPQEFKKNIRALLGELKTKLESYNFDNEFLKNQQNWIDYN
YVYALIKYPDIYKFFIRKEVELPKDFYAERDAIDFDNAQEFERNEVYRTLVKIKYFEQIG
ENPNNPERIDNFIKLISTLKSDNIRAYFAENLVLLIKPGNTENKKILNFILHNVKDKKVI
QDAKEAYHKTLKLAPGKPAPLFTNYENAQGGTTSLTDLKGKRLYVSIWTTWCLPCKTKLA
DLRVLQEKLKGENIEFVSIAIENDKQEWREMVKKREYKGVQLIADKASESQFIKECDITQ
IPTFLIIDEKGRIVSLNAPQPSDPDIEKVLKGKK
Download sequence
Identical sequences A0A250FGU4
WP_002682043.1.93208

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]