SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A250WEP8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A250WEP8
Domain Number 1 Region: 2-30
Classification Level Classification E-value
Superfamily Proteinase A inhibitor IA3 6.8e-16
Family Proteinase A inhibitor IA3 0.0006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A250WEP8
Sequence length 68
Comment (tr|A0A250WEP8|A0A250WEP8_YEASX) Cytoplasmic proteinase Pep4 pinhibitor {ECO:0000313|EMBL:GAX69172.1} OX=4932 OS=Saccharomyces cerevisiae (Baker's yeast). GN=SCKG_2273 OC=Saccharomycetes; Saccharomycetales; Saccharomycetaceae; Saccharomyces.
Sequence
MNTDQQKVSEIFQSSKEKLQGDAKVVSDAFKKMASQDKDGKTTNADESEKHNYQEQYNKL
KGAGHKKE
Download sequence
Identical sequences A0A250WEP8 G2WKM7
YMR174C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]