SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A250WK53 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A250WK53
Domain Number 1 Region: 1-82
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.56e-19
Family Calponin-homology domain, CH-domain 0.00019
Further Details:      
 
Domain Number 2 Region: 159-241
Classification Level Classification E-value
Superfamily EB1 dimerisation domain-like 0.000000000000392
Family EB1 dimerisation domain-like 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A250WK53
Sequence length 305
Comment (tr|A0A250WK53|A0A250WK53_YEASX) Microtubule-binding protein {ECO:0000313|EMBL:GAX70930.1} OX=4932 OS=Saccharomyces cerevisiae (Baker's yeast). GN=SCKG_4031 OC=Saccharomycetes; Saccharomycetales; Saccharomycetaceae; Saccharomyces.
Sequence
MDSIYGDLPMNRVKFNATAEYEFQTNYKILQSCFSRHGIEKTVYVDKLIRCKFQDNLEFL
QWLKKHWIRHKDESVYDPDARRKYRPIITNNSATKPRTVSNPTTAKRSSSTGTRSAMSGG
LATRHSSLGINGSRKTSVTQGQLVAIQAELTKSQETIGSLNEEIEQYKGTVSTLEIEREF
YFNKLRDIEILVHTTQDLINEGVYKFNDETITGHGNGNGGALLRFVKKVESILYATAEGF
EMNDGEDELNDKNLGEHGTVPNQGGYANSNGEVNGNEGSNHDVIMQNDEGEVGVSNNLII
DEETF
Download sequence
Identical sequences A0A250WK53

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]