SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A250XFK2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A250XFK2
Domain Number 1 Region: 89-154,194-254
Classification Level Classification E-value
Superfamily EF-hand 7.97e-35
Family Calmodulin-like 0.033
Further Details:      
 
Domain Number 2 Region: 282-355,388-453
Classification Level Classification E-value
Superfamily EF-hand 1.8e-21
Family Calmodulin-like 0.071
Further Details:      
 
Domain Number 3 Region: 6-48
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00000000000123
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A250XFK2
Sequence length 475
Comment (tr|A0A250XFK2|A0A250XFK2_9CHLO) Uncharacterized protein {ECO:0000313|EMBL:GAX81847.1} KW=Complete proteome OX=1157962 OS=Chlamydomonas eustigma. GN=CEUSTIGMA_g9275.t1 OC=Chlamydomonadales; Chlamydomonadaceae; Chlamydomonas.
Sequence
MSSKYQKPYTIPEGFPELLKSFTREILRAQPDNIYEFGAQYFSEVLANQGAPQYQGVADV
GPEGVETLSDVAAVLDIQNLSPAELEPIIMQLFLAADTDQSGFLDRSEFTQVLKSANLNL
SNKVIRQILAEADENEDNVIEYKEFLPVMIDILQGLKATGQAQDMMGRADELVRGAVEDM
LVHGMSKQELEALMRKVFIKADADQSGSLDRKEFRDALKAAKLGLTRRDINLIMSSADTD
QDGLISYEEFIPVCFQVLVERFKDEIVTNDILSNQDGLQGMLLQAFQAADQEGTGTLSQT
KVKKILEDLSYESLGLSTLQLVTLMSQAPTTQDGAVHYVQFVPIASNIIYQMYDVDSIKL
RIQAVKQVADAGGVQMMTGMDFESLRALLQQLFEEADVNGTGQLTLPEVMQVLEQLGSDE
TIQLSDLHMKAMFNAIDVDDNGLVDWYELVSFICDAIEHVEREHYISQMAGQMQR
Download sequence
Identical sequences A0A250XFK2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]