SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A250YE54 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A250YE54
Domain Number 1 Region: 135-273
Classification Level Classification E-value
Superfamily ISP domain 4.19e-39
Family Rieske iron-sulfur protein (ISP) 0.000000541
Further Details:      
 
Domain Number 2 Region: 79-147
Classification Level Classification E-value
Superfamily ISP transmembrane anchor 9.59e-24
Family ISP transmembrane anchor 0.0000304
Further Details:      
 
Domain Number 3 Region: 1-57
Classification Level Classification E-value
Superfamily Non-globular alpha+beta subunits of globular proteins 2.32e-19
Family Ubiquinol-cytochrome c reductase 8 kDa protein 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A250YE54
Sequence length 274
Comment (tr|A0A250YE54|A0A250YE54_CASCN) Cytochrome b-c1 complex subunit Rieske, mitochondrial {ECO:0000256|RuleBase:RU004494} OX=51338 OS=Castor canadensis (Beaver). GN=UQCRFS1 OC=Castoridae; Castor.
Sequence
MLSVAARSGPFAPVLSATSRGVAGALRPLVQASVPAAPEPPVLDVRRPFLSRESLSGQAA
GGPLVASVGLNVPASVRYSHTDVKVPDFSDYRRTEVLDSTKSSKESVEARKGFSYLVTAT
AAVGVAYAAKNTVAQFVSSMSASADVLAMSKIEIKLSDIPEGKNMAFKWRGKPLFVRHRT
KKEIEQEAAVEMSQLRDPQHDLERVKKPEWVILIGVCTHLGCVPIANAGDFGGYYCPCHG
SHYDASGRIRKGPAPLNLEVPLYEFTSDDMVIVG
Download sequence
Identical sequences A0A250YE54
XP_020029761.1.5219

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]