SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A251NRE3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A251NRE3
Domain Number 1 Region: 110-211
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.00000000706
Family Pseudo ankyrin repeat 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A251NRE3
Sequence length 433
Comment (tr|A0A251NRE3|A0A251NRE3_PRUPE) Uncharacterized protein {ECO:0000313|EMBL:ONI01290.1} KW=Complete proteome; Reference proteome OX=3760 OS=Prunus persica (Peach) (Amygdalus persica). GN=PRUPE_6G131500 OC=Amygdaleae; Prunus.
Sequence
MAWYLYPKTYPTLNETNRNALFFCYIDTGLYDLAMKMLEDDTTLAMARNSNAETALHVLA
RRPLEFGGRSTLGMCSRLMNSLVSGIEDSYKSSKQTKALELVECLWNQILKHNDDDVMCL
ITEPSEVLFDATRLGNYEFLSVLINAYPDLLWETDDENRTIFHVAVLYRHASIFNLVHET
GSIKDIIVTYTDDENNNILHLAAKLAPQNQLNLVSGAALQMQRELVWFEEVKKIVQPVSI
DMKNKDGKTPRELFTSEHEGLLCKGESWMKNTANSCMLVATIITTVVFSAAFSIPGGIAD
NTGAPKFLKDTAFLIFAISDGVALFSSSTSMLMFLYILTSRYAENDFLKSLPLKLMVGLA
SLFISMTSMMIAFSTAFYLSCHYGLRFVSDFIFIFAFVPVVLFVFLQYQLLCDMFLSTYY
SSLIFQPRKHMIQ
Download sequence
Identical sequences A0A251NRE3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]