SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A255CLQ5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A255CLQ5
Domain Number 1 Region: 31-228
Classification Level Classification E-value
Superfamily Hypothetical protein YwqG 0.000000000235
Family Hypothetical protein YwqG 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A255CLQ5
Sequence length 229
Comment (tr|A0A255CLQ5|A0A255CLQ5_9BACI) Uncharacterized protein {ECO:0000313|EMBL:OYN66172.1} KW=Complete proteome OX=561879 OS=Bacillus safensis. GN=CFH85_04300 OC=Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus.
Sequence
MEIKAFRQLNLIGKTPAIAKIGGFRPDPAVHSWFAGHFFIDPHQGWPTDQDGAMIPILQI
YLPEVPGGMSGFNECKMIQIFLNQKALPIDITKNGEGWKLIEYSTIEELEVVETPEEVRG
LKPFQIQWNKSEQRDYPCWEEAWSYVDLTEVNESEEATDHFFNQYTNYSFTKIGGYGAYI
QSPPHQQQGEFMLQIASEEKPRFMIGDNGTMYFYYNKELKEWFMHWDCF
Download sequence
Identical sequences A0A255CLQ5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]