SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A255X050 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A255X050
Domain Number 1 Region: 1-137
Classification Level Classification E-value
Superfamily Mog1p/PsbP-like 7.85e-44
Family PA0094-like 0.0004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A255X050
Sequence length 140
Comment (tr|A0A255X050|A0A255X050_RALSL) Uncharacterized protein {ECO:0000313|EMBL:OYQ10282.1} KW=Complete proteome OX=305 OS=Ralstonia solanacearum (Pseudomonas solanacearum). GN=B7R77_23375 OC=Burkholderiaceae; Ralstonia.
Sequence
MYQMQEGSMSLPADWIDKTMNVFVSASTGTEGVSFVVTRERLPWGMQFGEYVASELHKLA
RQVPGYEAVGGGEAQVSGRAAYAHEYKWTNNGSPLQQLLTMVEHGKQVLMLTFTAPGVPS
PSQKALVEGVIQSLRLTEPA
Download sequence
Identical sequences A0A255X050
WP_094395813.1.9888

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]