SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A256C0G3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A256C0G3
Domain Number - Region: 80-114
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0314
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0096
Further Details:      
 
Domain Number - Region: 103-172
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.0645
Family DnaQ-like 3'-5' exonuclease 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A256C0G3
Sequence length 207
Comment (tr|A0A256C0G3|A0A256C0G3_9GAMM) Type I-F CRISPR-associated endoribonuclease Cas6/Csy4 {ECO:0000313|EMBL:OYQ71284.1} KW=Complete proteome OX=400946 OS=Wohlfahrtiimonas chitiniclastica. GN=B9T13_01075 OC=Bacteria; Proteobacteria; Gammaproteobacteria; Wohlfahrtiimonas.
Sequence
MKYYIELTLIENRQENLYSLWSRIFTQIHLAFVERKDKNNRIHYGVSFPNYFFNERASIG
ILGDKIRIFAETKEELFFLSLPKWLDRLLDSVHIQSIKEVPSNIEGYAKYFYCRPKGESR
LRKEKKGYAEYYAQSHSVSVDEALSRYDDWEFKKVYYPYIQMKSLHRDNSFKLFVKKEVV
QEENLENSTHQLFTTYGLSAGGIVPEF
Download sequence
Identical sequences A0A256C0G3 L8Y439
WP_008314383.1.21142 WP_008314383.1.47891 WP_008314383.1.64346

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]