SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A256FNV4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A256FNV4
Domain Number 1 Region: 169-222
Classification Level Classification E-value
Superfamily Heme iron utilization protein-like 0.0000000122
Family HemS/ChuS-like 0.019
Further Details:      
 
Domain Number 2 Region: 13-81
Classification Level Classification E-value
Superfamily Heme iron utilization protein-like 0.0000392
Family HemS/ChuS-like 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A256FNV4
Sequence length 237
Comment (tr|A0A256FNV4|A0A256FNV4_9RHIZ) Heme utilization ChuX/HutX family protein {ECO:0000313|EMBL:OYR16519.1} KW=Complete proteome; Reference proteome OX=94627 OS=Ochrobactrum grignonense. GN=CEV33_4530 OC=Brucellaceae; Ochrobactrum.
Sequence
MSEQPIRVKLLADAADVLKTLPSMGKLMINSKSGGATHERIGVVEQVEVRDGWIYFSGSE
HHSRIDLSAIASLIADRSSVMQEKVYPRIDLLAEDESVVGSVIGFDGAEPFDQALNGFAF
SALPPKDKDRGAGEALEVGDDEPGLKPFAAAQRNKAEVRIALDLPAFKQEWSGEMPTVRP
SRGFINVMKPDFHLHLKAGHVASWHEIEEGDEYRFYALNETGQQTGLVVSGKKDAFR
Download sequence
Identical sequences A0A256FNV4
WP_094539532.1.70989

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]