SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A256YAL7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A256YAL7
Domain Number 1 Region: 5-57
Classification Level Classification E-value
Superfamily Nop10-like SnoRNP 6.02e-18
Family Nucleolar RNA-binding protein Nop10-like 0.0004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A256YAL7
Sequence length 69
Comment (tr|A0A256YAL7|A0A256YAL7_9ARCH) Ribosome biogenesis protein Nop10 {ECO:0000256|HAMAP-Rule:MF_00803} KW=Complete proteome; Reference proteome OX=2012534 OS=archaeon ex4484_74. GN=B6U92_01245 OC=Archaea.
Sequence
MGKRIYKCLKCGRYTLRTDTCPVCGSQVAIAHPPRFSLVDKYGRYRRLLKKSIGLLPTTN
ETEEKKDVV
Download sequence
Identical sequences A0A256YAL7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]