SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A257AJK1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A257AJK1
Domain Number 1 Region: 5-79
Classification Level Classification E-value
Superfamily Pre-PUA domain 1.18e-22
Family Archaeosine tRNA-guanine transglycosylase, C2 domain 0.00078
Further Details:      
 
Domain Number 2 Region: 81-155
Classification Level Classification E-value
Superfamily PUA domain-like 1.71e-17
Family PUA domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A257AJK1
Sequence length 160
Comment (tr|A0A257AJK1|A0A257AJK1_9EURY) Pseudouridine synthase {ECO:0000313|EMBL:OYT64359.1} OX=1978123 OS=Methanosarcinales archaeon ex4484_138. GN=B6U67_00035 OC=GOM Arc I cluster.
Sequence
MFCVRSDELMKIRLIADYQFGRGTGRLLFSDDVAVTHSRTGRIRQVFEDGERLATLRARD
GMLTLSIRGAVKLHKSLPYPIVRVVVSSEAAPFVAEGKTAFAKHAIDVDPEIRSGEEVLI
VNESDDLLGVGKALLAPTEMLSAMRGVGVETRFGVGKIEK
Download sequence
Identical sequences A0A257AJK1 A0A2G1NYY0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]