SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A257MD49 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A257MD49
Domain Number 1 Region: 14-49
Classification Level Classification E-value
Superfamily Pre-PUA domain 0.0000294
Family Archaeosine tRNA-guanine transglycosylase, C2 domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A257MD49
Sequence length 85
Comment (tr|A0A257MD49|A0A257MD49_9EURY) Queuine tRNA-ribosyltransferase {ECO:0000313|EMBL:OYV09512.1} KW=Complete proteome OX=1917472 OS=Methanosaeta sp. NSP1. GN=CG437_989 OC=Methanosaetaceae; Methanothrix.
Sequence
MLVTDDSHMDTTGFDRVLYYKPPFGPYPAELAETYPFNAEVPEVADSEALKQAEKIMHDL
IRNNPEARFSIRLKHDLPEKMPEQR
Download sequence
Identical sequences A0A257MD49

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]