SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A257R6Q5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A257R6Q5
Domain Number 1 Region: 28-231
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.000000000000523
Family Pseudo ankyrin repeat 0.0000599
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A257R6Q5
Sequence length 677
Comment (tr|A0A257R6Q5|A0A257R6Q5_9GAMM) Uncharacterized protein {ECO:0000313|EMBL:OYV56352.1} OX=1970394 OS=Legionella sp. 21-45-4. GN=B7X00_00225 OC=Legionellaceae; Legionella.
Sequence
LPVLEHLESQAPDQIQAMIAVNRFSAYRYAAENGHLPVLEHLESQAPDQIQTMIAANTFA
AYRFAAENGHLLVLKHLESQAPDQIQVMIAAYDFYAYRYAAENSHLEVCNHLLSQSSACF
AYAERHQWEYGAIIRPFIQERLSTLHQESLTVPAQTVFDIADSEQAKRCFYILRHLIRCN
ERQFDDELRFLLSIPAVKDLAHQAVTPNQPNELLRLALTTNNQAAAEILLTIPAVRTLAE
QNDYYRAEARGHLDLARLAQDRESSMTALTQGEQARLDTAIRHYQPLLQAAGVSQVMANL
REELEKRFAQNPACFEDATGRVIQLPLTFADFNGLNLNAEDYQNALTAYYQHKDHTAWRY
LAKPNPWMNPEASYVYTNEDHSERWSTFEDYQPLISLLWLAAIDSERMPTEDHTLEGRIN
HFIDELAQIGRAHNWDGTRTNAKGKEEEYDDLSGDRPSCYSGVKRRLFQAVMGHPLISIL
TQDIILEEIKSVAKAHFETQLLKVDSAQLQDAYLDYSYNPRDEVREESKAQLALLNISDE
ALRQFDAYLTNKYGAQFTEDASFIRLVRVKLQLQPNSNEPSFHYHAILLDGLTGFYNLLF
KKNLVSDAGDSDSYEEGELEVLTQTITEEDNEALSTSTPSPSPIQAHSVNNRGQFFSAIP
PREREAREQGSERSPFI
Download sequence
Identical sequences A0A257R6Q5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]