SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A261B7V5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A261B7V5
Domain Number 1 Region: 116-197
Classification Level Classification E-value
Superfamily WWE domain 4.19e-20
Family WWE domain 0.002
Further Details:      
 
Domain Number 2 Region: 17-64
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000000471
Family RING finger domain, C3HC4 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A261B7V5
Sequence length 219
Comment (tr|A0A261B7V5|A0A261B7V5_CAERE) Uncharacterized protein {ECO:0000313|EMBL:OZG06412.1} KW=Complete proteome OX=31234 OS=Caenorhabditis remanei (Caenorhabditis vulgaris). GN=FL82_02074 OC=Rhabditoidea; Rhabditidae; Peloderinae; Caenorhabditis.
Sequence
MASSSDARPPSNATPLDEECAICFGEIILRCTLACKHQFCFDCSKTWLLQAGNCPVCRGE
ADVNILNEPQQLNLKMGLPKGRKRAHDAQSGEEDDMEDVKPNVEELKAAMAKKKFVSTTN
AKIFWLYETKTGGAWWRFSLLNEEPMEEAFKANLGTLDMEILGRMYTINFTDMTQRQKQY
PDIVRNIKRVDEEEYDQLTIIGIGGCVQKNDKVNPWSVD
Download sequence
Identical sequences A0A261B7V5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]