SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A267DE45 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A267DE45
Domain Number 1 Region: 106-487
Classification Level Classification E-value
Superfamily Ankyrin repeat 9.18e-77
Family Ankyrin repeat 0.000045
Further Details:      
 
Domain Number 2 Region: 372-745
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.01e-65
Family Ankyrin repeat 0.0000659
Further Details:      
 
Domain Number 3 Region: 698-991
Classification Level Classification E-value
Superfamily Ankyrin repeat 5.45e-48
Family Ankyrin repeat 0.0000986
Further Details:      
 
Domain Number 4 Region: 1215-1459
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.01e-33
Family Ankyrin repeat 0.0017
Further Details:      
 
Domain Number 5 Region: 1022-1164
Classification Level Classification E-value
Superfamily Ankyrin repeat 8.49e-29
Family Ankyrin repeat 0.00043
Further Details:      
 
Domain Number 6 Region: 2-37,71-119
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0000379
Family Pseudo ankyrin repeat 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A267DE45
Sequence length 1468
Comment (tr|A0A267DE45|A0A267DE45_9PLAT) Uncharacterized protein {ECO:0000313|EMBL:PAA47570.1} KW=Complete proteome OX=282301 OS=Macrostomum lignano. GN=BOX15_Mlig004077g1 OC=Macrostomida; Macrostomidae; Macrostomum.
Sequence
MLAIMKKHRPLIRLLVERGTNLQWRNKKGFTAADLAFIAEDRESLDLIQERERSLQFDCK
VHNESILSFAQKGSTKMIEYWLTNYPQTDDVKPCDLQYKDGRTIAFTAALNGSEELLALV
DSLDADLDLPDNSNSSPLFCAAQNGYDSIVRMLIDKGCDVNRVRDTGRTALFSAIVNSHL
NIVKILVEEGANFNIKDKTGTCPLACSIVCGSQEIFDYLLDEKAADCSVIDESGNDLVLI
AALYKRFQMLRQLHERGLPLDAVNNKDGETALLSACQVRCPEMVEYLADRGCNLNVVNKN
GVTPVLRASFNNDLATVKVLAKRKAQLDVPNKRGETAILVSAQKKSLPLVEYLYKKHCDI
NVIDKNGRTLAYYAATTDNMEILHALIRYSAPLDCQDKKGNTPLMIAAMKPANLEMLQIL
VKNKCNVETRNNAGNTACSIAAKQGSLDVLQYLDSIGEELVNITKKGKTIIMQASKRNKL
AVLRLIKASEKAMSDLEATCDLGRTAVHYAAVGGHTEAVDFLSNEMHAETDAKDFQGNTP
FMLAVEKKHKEVAEKLYDLGADVNIRNNGGENAAHLAVQAESLELLRFLDQKGCFLDQED
KSGKTPLMLACEKKKMALINFLLARNCFPKSFSKDGRQVIHVACESGKAHIAKRFIDLGV
PVHAADSSGISTLMLAAQSGSSEIIEALITRKQQLVEMKDIFGKSALEYAIVWDQEKVIN
QLIDAGCNVDNQQKDGRTPLMLAIASTSKSADEVVQTLIERGCSVDAVTEDGFNVAHVAC
KYNKLQVLKVLMEKGVSIESLTKSSDSCLTLAVSKGSAELIGLLVDAGLSKSHTNCEGHS
AVSLGYQRGNEEVLSKLLPVSDSDVSNKYANGNTLLHLACEGGLKKLIESLLDRDPTLLE
AKNSKLETPLHVASRCSKLELVDLLLQRGAEINSADEMGETPLFMAISAGNFTICKSILD
KKPDLSLLNSEGVSAMAKAYHKGKTSIIRMLQAEEAPLFPEKLPASFEVFRTNLLQMKFR
NLNELLNAGLSIDRLEKDWHLLHLGIETSRSELITELLNRGASVNVKDEQGNTPLLSAVI
FGRIDVARQILEKHPEAKNDVNNKGDTVLHVAAKENKLSTLSWLLTSFDFEKNVRNKQGQ
TALHIAASKGNVKMYELLVQKGFDSALILEEEQKKYRVSHISAMSNSMSLLRHLRAKGEL
SIQFSKKTPSVFEILVIEGQLKVLQQLCNEMGQNYEDENFFGARNMAFFTGHEAMCTWMI
NVRVDLDRPDRDGETPISRSVVGGNFHLCRELIEKVKCDLSVKTKHGVSLVQEAVVANHE
PILRYLIQRNASIEEADNDGDTPLLEAVNLEKTRLTLVLHSEYKCDLKRTNRLNRNAAHL
GAIAGNLENLKYLKQNLPAELFDASDLHCDTPLMLSVLHEKTDAFSYLLENFALDVNHQN
ETKSSALHWAAQKSNLSAVAVVCWTKMA
Download sequence
Identical sequences A0A267DE45

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]