SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A267DI83 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A267DI83
Domain Number 1 Region: 6-67
Classification Level Classification E-value
Superfamily RNA polymerase subunit RPB10 7.59e-28
Family RNA polymerase subunit RPB10 0.0000987
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A267DI83
Sequence length 68
Comment (tr|A0A267DI83|A0A267DI83_9PLAT) Uncharacterized protein {ECO:0000313|EMBL:PAA48272.1} KW=Complete proteome OX=282301 OS=Macrostomum lignano. GN=BOX15_Mlig025048g2 OC=Macrostomida; Macrostomidae; Macrostomum.
Sequence
KSSLIMIIPIRCFTCGKVVGDKWEQFINMLQGGYGEGDALDMLKINRYCCRRMLLSHVDL
IEKLLNYV
Download sequence
Identical sequences A0A267DI83

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]