SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A267DWN2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A267DWN2
Domain Number 1 Region: 867-1044
Classification Level Classification E-value
Superfamily Caspase-like 9.12e-34
Family Caspase catalytic domain 0.00018
Further Details:      
 
Domain Number 2 Region: 402-429,458-736
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.85e-32
Family Ankyrin repeat 0.0017
Further Details:      
 
Domain Number 3 Region: 113-263,427-511
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.14e-31
Family Ankyrin repeat 0.0043
Further Details:      
 
Domain Number 4 Region: 250-454
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.74e-24
Family Ankyrin repeat 0.00054
Further Details:      
 
Domain Number 5 Region: 6-169
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0000000000000325
Family Ankyrin repeat 0.0014
Further Details:      
 
Domain Number 6 Region: 684-714,750-808
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.000000301
Family Pseudo ankyrin repeat 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A267DWN2
Sequence length 1082
Comment (tr|A0A267DWN2|A0A267DWN2_9PLAT) Uncharacterized protein {ECO:0000313|EMBL:PAA53037.1} KW=Complete proteome OX=282301 OS=Macrostomum lignano. GN=BOX15_Mlig032136g1 OC=Macrostomida; Macrostomidae; Macrostomum.
Sequence
DCLSVRDQQGSTPIHLAAEFQGADSMQFFKSVLGSDCFHQPGNCQRTAIHQAAMNKKTNS
CLKWLVNECGTDCLSVRDQQGNTPVHLAAWKQGADSMQFFKSVLGSDCFHQPGYLQETAI
HLAAMNETNSCLKWLVNECGTDCLSVRDQQGDTPVHLAAWKQGADSMQFFKSVLGSDCFH
QPGRFQRTAIHCAAENEATNSCLKWLVNECGTDCLSVRDQQGNTPVHLAAFCQGADSMQF
FKSVLGSDCFHQPGCVQRTAIHWAARNEATNSCLKWLVNECGTDCLSVRDQQGNTPVHLA
ALFQGADSMQFFKSVLGSDCFHQPGRFQRTAIHCAAENEATNSCLKWLVNECGTDCLSVR
DQEGDTPVHLAAFCQGADSMQFFKSVLGSDCFHQPGRFQRTAIHQAAMNETNSCLKWLVN
ECGTDCLSVRDQRGKTPVHLAAWKQGADSMQFFKSVLGSDCFHQPGYLQETAIHLAAMNE
TNSCLKWLVNECGTDCLSVRDQQGNTPVHLAAFCQGADSMQFFKSVLGSDCFHQPGCVQR
TAIHWAARNEATNSCLKWLVNECGTDCLSVRDQRGNTPVHLAAWKQGADSMQFFKSVLGS
DCFHQPGRFQRTAIHCAAENEATNSCLKWLVNECGTDCLSVRDQQGNTPVHLAAWKQGAD
SMQFFKSVLGSDCFHQPGYLQETAIHLAAMNETNSCLKWLVNECGTDCLSVRDQQGDTPV
HLAAWKQGADSMQFFKSVLGSDCFHQPGRLQRTAIHWAARNEATNSCLKWLVQQLGRSCL
LKRGFNGITAAHLAAQYQDVETLSFIVDLLGVSVLDLRDASHFLPWKRKSVADYAKLNSR
HGSQLTRWIAERRHQQRSQSEKTPTVPLHEDFYQVTNPQGFCLIININTYSTGSGEEERK
GSERDVDRVRKLFRKLSFTIKEVQNPTTAEIDDFLNETKKSKELAKHGSFVCFLMAHGRK
DPQGRDCIIDGHGVQSPVLELAAKFKASVCPDLAGKPKIFFVQACRGSGTDEVTHRGLAV
DQLPPEFAQNPALYPPESDFLFCFPPQRVRCPTATLRLAASSCRPCATTSSNFTQRSTWR
TS
Download sequence
Identical sequences A0A267DWN2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]