SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A267EGA5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A267EGA5
Domain Number 1 Region: 273-395
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.31e-32
Family cAMP-binding domain 0.00018
Further Details:      
 
Domain Number 2 Region: 142-262
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 3.67e-26
Family cAMP-binding domain 0.0000459
Further Details:      
 
Domain Number 3 Region: 20-58
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0000000000379
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A267EGA5
Sequence length 424
Comment (tr|A0A267EGA5|A0A267EGA5_9PLAT) Uncharacterized protein {ECO:0000313|EMBL:PAA60545.1} KW=Complete proteome OX=282301 OS=Macrostomum lignano. GN=BOX15_Mlig030290g1 OC=Macrostomida; Macrostomidae; Macrostomum.
Sequence
PAPPLPPHLAPQPSTTSQMSSFTVPDGLTELLQDFTVAVLRAQPANLVQFASAYFQRLDL
GQSSEAAGPAAAAVASSDSAERQLRREDSGAEIDDDDDLAALPDSAAAARVCGACSRRRV
SVAAPSFDPEKHEATYQRRVVPKSDEQRRRLMETVKHILLFRSLDRIGLGHVIDAMEEKP
VTAGEVIIEQDGEGDNFYVIERGVFEAFVRDKASSESRHVLTYNHEGSFGELALMYYCPR
AATVIAKTDGVLWSLDMETFQQKVLMAAFKHRKKYEAFLSSVHLLAELTQYERQNVADAL
KEREFSDGEPILHQGEIGNEMFFVEEGEVKVMRRNSDNGLEMQVNLLGKGDYFGELALIT
KEPRAASCYAVGHTKVCVLHVSDFERLLGPCVEVMQRNIDAYKKQLSDIFGDEAGKAALA
RAAV
Download sequence
Identical sequences A0A267EGA5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]