SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A267EIJ9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A267EIJ9
Domain Number 1 Region: 291-498
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.85e-28
Family Nucleotide and nucleoside kinases 0.00034
Further Details:      
 
Domain Number 2 Region: 85-203,234-283
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.46e-20
Family Nucleotide and nucleoside kinases 0.0011
Further Details:      
 
Domain Number 3 Region: 40-77
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.000000994
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0033
Further Details:      
 
Domain Number 4 Region: 202-230
Classification Level Classification E-value
Superfamily Microbial and mitochondrial ADK, insert "zinc finger" domain 0.00000275
Family Microbial and mitochondrial ADK, insert "zinc finger" domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A267EIJ9
Sequence length 507
Comment (tr|A0A267EIJ9|A0A267EIJ9_9PLAT) Uncharacterized protein {ECO:0000313|EMBL:PAA61340.1} KW=Complete proteome OX=282301 OS=Macrostomum lignano. GN=BOX15_Mlig030341g1 OC=Macrostomida; Macrostomidae; Macrostomum.
Sequence
KKFNIFCHFVVYTFSGYQQLFSVEIMDQTAKPLQIPPTFALYAEKHNLFDLYHDLISQLL
IHKPADPLQFLIESLEKDNARVSTVMVLGPPASGKHTIGKMLAGRLRCPHLTMQNMIPEV
DRKLRQKAEFYLAEKQPIPTELWTSIVKNRLSIQDCNRKGWVMSGFPQTRDQAVALQTAG
VIPDHVIFLEAKPTVLAERAIGKRWDPETGDIYHLVFDQPTDDDVLERLVECPGNSDSEI
NERIREFEGRIIELAPCYSNVGLKVNADQPVADVFHHALEFVSSPRRSSAPRNPRAILIG
PPGSGRDTQAALLAAKYGLVNLNCGQLIKQAISGETKAGGAMKNYVDRGMPVPDAILLKL
LKERLCQLDCITRGWVLHGYPRTRGQAEQLADAGFQPNRVFFMELGNAQVLERLTNRMTD
PVTGRRYQSIYDPPTDAQVKERLMQHPRDTEAEVNRRLSRYSTFREELRDFYASKSLALD
VNCDQDVETVFETLESHIVTPLPKNFD
Download sequence
Identical sequences A0A267EIJ9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]