SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A267EIL5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A267EIL5
Domain Number 1 Region: 85-125
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0000392
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A267EIL5
Sequence length 140
Comment (tr|A0A267EIL5|A0A267EIL5_9PLAT) Uncharacterized protein {ECO:0000313|EMBL:PAA60612.1} KW=Complete proteome OX=282301 OS=Macrostomum lignano. GN=BOX15_Mlig011172g2 OC=Macrostomida; Macrostomidae; Macrostomum.
Sequence
FTGSFLTKLAILKQNRSQTMAEETIETPDNLSEVSVSVSNSRPSTAAKPEASTTTKAETE
SMVPASDQEKGKKKSEVVEDPYFKAMDYLEEHNIIQFFQKLTTAIVFERPFDPVQYIVDK
AEEVAESLSDEQLKKFYKKA
Download sequence
Identical sequences A0A267EIL5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]