SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A267EXT0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A267EXT0
Domain Number 1 Region: 31-203,325-432
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.62e-68
Family Ankyrin repeat 0.00093
Further Details:      
 
Domain Number 2 Region: 516-604
Classification Level Classification E-value
Superfamily DEATH domain 0.0000000000000404
Family DEATH domain, DD 0.019
Further Details:      
 
Domain Number 3 Region: 186-265
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0000000101
Family Pseudo ankyrin repeat 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A267EXT0
Sequence length 623
Comment (tr|A0A267EXT0|A0A267EXT0_9PLAT) Uncharacterized protein {ECO:0000313|EMBL:PAA65542.1} KW=Complete proteome OX=282301 OS=Macrostomum lignano. GN=BOX15_Mlig016846g3 OC=Macrostomida; Macrostomidae; Macrostomum.
Sequence
MAESSMPKRSEDDCDMVTSLQEPFLSKAELALHEAARSGNRTRVEKLIKVTGKIDCRNSL
DRTALHMAASKGHREIVRILIESGKASVEVTDKFGMSPLMWATYFGHIEVVNLLLDRSAN
IRRRNKLGMHVVHIAAEQNHCELVKIFINKTKKTLLNDTEKNGMTAVMIAAAKGNGEVVQ
SLISLGADLKIRDNRKRTVLHVAAESGNERVLDNLIADGPKMRELINERDDRGRMPIHYA
VEKGFAGAVEILLAFGASPNDTTDSEEVETVANSATPIAVHPEMSPFLLAAREKKPNEDE
QPAEAFADGAAPGEGGKPRPQHGEILRRLVQAGTDIDAVNSNGYTALHYAALNDDANAVY
TLVHFGCDISAKNNRMQTPLHMAAEQNRLRAAEALLLSGAPLNIADKTGKTPLVLATQGG
CICIVDMIIKAERHREKVQRVLKNEPNQWDSAAQADQLDAAAAFTPDGYENRSNINESEN
IDDELTESFILENGTAPAYRLREFNQPYADEFKLFLWKLAFDHLRYGEWKKLALFWRFRL
DHITAIEQQYSDEKSYKQHGYRVLCIWFHGIGWDTPIRGLYEALVQIDRRSLAERVRKKL
DRSAEYYSAGRKIHHEGRSCTIQ
Download sequence
Identical sequences A0A267EXT0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]