SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A267FDS4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A267FDS4
Domain Number 1 Region: 104-189
Classification Level Classification E-value
Superfamily Nucleoplasmin-like core domain 0.000000000249
Family Nucleoplasmin-like core domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A267FDS4
Sequence length 271
Comment (tr|A0A267FDS4|A0A267FDS4_9PLAT) Uncharacterized protein {ECO:0000313|EMBL:PAA71219.1} KW=Complete proteome OX=282301 OS=Macrostomum lignano. GN=BOX15_Mlig018811g1 OC=Macrostomida; Macrostomidae; Macrostomum.
Sequence
MSLVDVQFGADTQRDIQSQQQMSFHFWSCQLAEANPKYRWEPERATTFSANGKDDRPKRQ
VGQHDERNGSDGEKAKEAEGKGEEQTKGADQNGHHSNGEAAADADFMQHVLKVNACILGP
KAAGVHLIAVRTKCYGQDEPDTCPIVCIDPDSQRTVSLGYEFVLDSQNEVTFELAEGAGP
VWLTGLHQVRVHDPDDDGEADCDDDADEIDEESVDGSVDLNEEDDEDEDDYEDEEEEAAR
PVAKRVARASKTDQQRPVASPKKRKPAAKRT
Download sequence
Identical sequences A0A267FDS4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]