SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A267G035 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A267G035
Domain Number 1 Region: 15-58
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00000000392
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0029
Further Details:      
 
Domain Number 2 Region: 59-126
Classification Level Classification E-value
Superfamily EF-hand 0.0000277
Family Polcalcin 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A267G035
Sequence length 141
Comment (tr|A0A267G035|A0A267G035_9PLAT) Uncharacterized protein {ECO:0000313|EMBL:PAA79448.1} KW=Complete proteome OX=282301 OS=Macrostomum lignano. GN=BOX15_Mlig006014g1 OC=Macrostomida; Macrostomidae; Macrostomum.
Sequence
ATEPTKIMENWPRQQEAEMYLQKHKIRELFNNLSAQLIFEQPNDPKAFMVEHLKTLAGSK
AAPEKAPCLFDDSNLTAIFHMLDAAGRGYVTKNQYAEAMETLGLSHFDRYPPGGDNDMIT
LDTFVREGRKGLTKQSATYSG
Download sequence
Identical sequences A0A267G035

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]