SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A267GQG9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A267GQG9
Domain Number 1 Region: 375-540
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 8.35e-18
Family Nucleotide and nucleoside kinases 0.0093
Further Details:      
 
Domain Number 2 Region: 156-304
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000000174
Family Nucleotide and nucleoside kinases 0.0056
Further Details:      
 
Domain Number 3 Region: 4-46
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.000034
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A267GQG9
Sequence length 547
Comment (tr|A0A267GQG9|A0A267GQG9_9PLAT) Uncharacterized protein {ECO:0000313|EMBL:PAA88275.1} KW=Complete proteome OX=282301 OS=Macrostomum lignano. GN=BOX15_Mlig000750g1 OC=Macrostomida; Macrostomidae; Macrostomum.
Sequence
VTMADAKEYITKREIPQLFECLMTALMYHRPTDHLSFIQECVERVKLHGVSSVRWDLFLE
EGGGGANKAGRQLPPVTPPGSSRASSRAGSRADFVDKAKQPLPPIGAPVEAASAVEKAPP
PPPSTGDSEAPVAPQIEEQPQAAEQSKPPAAPIACPLVLLIGGPGSGRRRVCRELARRYD
FQAVCFGDLARGATAKDSLTNSAALALLTDALGRLPADCQGVFVEGFPWNEAQLGELLLQ
VQSIKCALLLDFHEAALRKRLEDRAVPADEAAARLEKFRSATLPVCRHLDDEGKLLLLPV
DGEPGDGAADADVSVVAGDAVALLERVLGAPSKPAAETSAPAAPHPTGPQLYIRTLDFDV
ESATESVERDTDLPACPILLLLGGPGSGRSALCRRLAAAFDGFVRVDARNALGGDSDADS
DNRPDGRVEAEALRRLLSSPALAGARCVLLEGYPTCEADLRDACARLGRPDLAVLIDCSE
TGLLARLASLPEEDVAARLRYFKEETLPVVRSLDAAGRLSVIDGDRSEEAVLADLKALID
FVIFNRR
Download sequence
Identical sequences A0A267GQG9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]