SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A267H6F9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A267H6F9
Domain Number 1 Region: 259-391
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 9.3e-31
Family cAMP-binding domain 0.00019
Further Details:      
 
Domain Number 2 Region: 123-243
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.19e-27
Family cAMP-binding domain 0.0000459
Further Details:      
 
Domain Number 3 Region: 8-45
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00000000034
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A267H6F9
Sequence length 408
Comment (tr|A0A267H6F9|A0A267H6F9_9PLAT) Uncharacterized protein {ECO:0000313|EMBL:PAA93142.1} KW=Complete proteome OX=282301 OS=Macrostomum lignano. GN=BOX15_Mlig009670g2 OC=Macrostomida; Macrostomidae; Macrostomum.
Sequence
MSSPTGPSFEVPDGLQSLLQDFTVSVLRRRPTNLVHFAAAYFRRLDLVNSAVEGDAVAVL
TVPAREDSGAETDDDLDIAAAAAAAAAEAGKVPPWRANRRPSVAAPSFDPEKSEATYQRK
IVPKSDEQRRRLTETVKHILLFRSLDRVSLSHVIDAMQELSVKAGDMIIEQDQEGDNFYV
IERGIFEAYVTDSVSGERRLGVTYNHSGSFGELALMYYCPRAATVIAKTDGVLWSLDLDT
FQQKVLMSAFKNRKKYEAFLAAVSLLSELTHYERQNVADALKEREYDDGEPILFQGDPGN
EMFFVEEGSVKVMRRHSDNGLETQVNHLEKGAYFGELSLITKQPRAASCYSVGRTRVCVL
HVSDFERLLGPCLEVMRRNIDSYRSQLREIFGDATSAAAAPLRVEASV
Download sequence
Identical sequences A0A267H6F9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]