SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A268AA13 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A268AA13
Domain Number 1 Region: 20-210
Classification Level Classification E-value
Superfamily MW0975(SA0943)-like 2.35e-51
Family MW0975(SA0943)-like 0.00062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A268AA13
Sequence length 217
Comment (tr|A0A268AA13|A0A268AA13_9BACI) Uncharacterized protein {ECO:0000313|EMBL:PAD20956.1} KW=Complete proteome OX=361277 OS=Terribacillus saccharophilus. GN=CHH64_10370 OC=Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Terribacillus.
Sequence
MLKLGLGILLMGSAVGLTACNNASPEEQVYNHLEETVSLESGYVEQQESLTDLEKKEQDL
YNEILQLGTDELDQIKSKSQEAIDLIGQRKDALAKEKESLDEAEAEFKEVDSIIDELESD
DAKQKAQTLYDTMEARYSAYDKLHEAYTKALDEDNTLYDMFQQDDITQDELTSQIEKINA
GYEEIKTANEEFNTQTEAFNEQKQQFYEAAGLNVENE
Download sequence
Identical sequences A0A268AA13

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]