SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A284QN33 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A284QN33
Domain Number 1 Region: 156-183,249-308
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0000034
Family Pseudo ankyrin repeat 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A284QN33
Sequence length 413
Comment (tr|A0A284QN33|A0A284QN33_9AGAR) Uncharacterized protein {ECO:0000313|EMBL:SJK97861.1} KW=Complete proteome; Reference proteome OX=47428 OS=Armillaria ostoyae. GN=ARMOST_01116 OC=Armillaria.
Sequence
MATVESPLNTVHQAYRRLTHPELVLFLKLRNLPTSGSDDELASRLTNHDFHLYHFPNASG
TISSSPSSASLLFPHPPKRHRTSGIPDLPVEILADIMDHVGDWELSRAVGVPTSIPRPLE
WSRASCTDHAMITGSLPLIRAVDPTVNPPTKIGADLAVRFGYVHVLEFFLSHHHGIFLSI
FKGDLIPVKASRHGRINILSWWKHGFEHHPDLVPPPKPGSIADAIDGASRNGQIASLDWW
MHCGHHMEYTEAALEYASSKNQIAVLQWWKEQHERHKLPLKIGRVMDMASTAGHVEVLEW
WATSQLDPKYDRHALQHASCHGKVEVLEWWLGSGLPLIFDQDALTGATRHNRPEVLEWWN
KSGLPIQYRMCDIEEALEDAIGGGENARQWWKHKGVDFNANDKEWMKLQNLNS
Download sequence
Identical sequences A0A284QN33

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]