SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A284RBT0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A284RBT0
Domain Number 1 Region: 5-65
Classification Level Classification E-value
Superfamily Preprotein translocase SecE subunit 0.000000000000222
Family Preprotein translocase SecE subunit 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A284RBT0
Sequence length 70
Comment (tr|A0A284RBT0|A0A284RBT0_9AGAR) Related to SSS1-ER protein-translocase complex subunit {ECO:0000313|EMBL:SJL06195.1} KW=Complete proteome; Reference proteome OX=47428 OS=Armillaria ostoyae. GN=ARMOST_09531 OC=Armillaria.
Sequence
MSEKLREFIEIPQQFARDGNQFLTRCTKPSSKEFVQICRAVAVGFAVMGFIGYFVKLIHI
PINNILVGGA
Download sequence
Identical sequences A0A284RBT0 A0A2H3CC19

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]