SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A284VSC8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A284VSC8
Domain Number 1 Region: 80-179
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.34e-22
Family Cold shock DNA-binding domain-like 0.000049
Further Details:      
 
Domain Number 2 Region: 1-77
Classification Level Classification E-value
Superfamily N-terminal, heterodimerisation domain of RBP7 (RpoE) 6.54e-18
Family N-terminal, heterodimerisation domain of RBP7 (RpoE) 0.0004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A284VSC8
Sequence length 223
Comment (tr|A0A284VSC8|A0A284VSC8_9EURY) DNA-directed RNA polymerase subunit E {ECO:0000313|EMBL:SNQ62195.1} KW=Complete proteome OX=1392998 OS=Candidatus Methanoperedens nitroreducens. GN=MNV_60076 OC=Candidatus Methanoperedenaceae; Candidatus Methanoperedens.
Sequence
MYKKMRLADTVRIAPELLGEPVEAAVKLALRDKLEGLVDKVIGSIVAVTDIVEVGEGHIL
AGDAGVYYDTVFDAITFMPELQEIIEGSVLEVVEFGIFVGIGPLDGLVHVSQLTDEYVSY
DERNSRLITKESGRSVTVGDHVRARIVAVSLNEREPRDSKIGLTMRQHALGKIDWLEEAR
EGKPKEGGEEKEAKPRKKKREEKKEVKKEDAAKAESAEIPGEA
Download sequence
Identical sequences A0A284VSC8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]