SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A285GHV9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A285GHV9
Domain Number 1 Region: 6-79
Classification Level Classification E-value
Superfamily Pre-PUA domain 9.15e-21
Family Archaeosine tRNA-guanine transglycosylase, C2 domain 0.0014
Further Details:      
 
Domain Number 2 Region: 82-156
Classification Level Classification E-value
Superfamily PUA domain-like 0.00000000000000238
Family PUA domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A285GHV9
Sequence length 159
Comment (tr|A0A285GHV9|A0A285GHV9_9EURY) Conserved protein with predicted RNA binding PUA domain {ECO:0000313|EMBL:SNY22764.1} KW=Complete proteome OX=51203 OS=Methanohalophilus euhalobius. GN=SAMN06295989_1177 OC=Methanosarcinaceae; Methanohalophilus.
Sequence
MAMTKEVSRIKQVRIMADYQFGKGCGNILFAGDITFKLSRTKRIRQIFSEGKRMATVRAR
DGMFTLSIEGASLIHSHLPTPGYRVMMCEDAIPFVSKGKTAFAKHVENIDPDLRAGDEVL
LVDKQDNLIATGQLLLAPEEVLAMQNGPAVDVRVGVNSS
Download sequence
Identical sequences A0A139CZX3 A0A1D2UVC7 A0A285GHV9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]