SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A285PX08 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A285PX08
Domain Number 1 Region: 235-333
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.000000000017
Family Pseudo ankyrin repeat 0.026
Further Details:      
 
Domain Number 2 Region: 140-225
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0000000000497
Family Pseudo ankyrin repeat 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A285PX08
Sequence length 353
Comment (tr|A0A285PX08|A0A285PX08_9VIRU) Ankyrin repeat {ECO:0000313|EMBL:SOB74161.1} OX=2023205 OS=Cedratvirus lausannensis. GN=BQ9231_00278 OC=Viruses; dsDNA viruses, no RNA stage; unclassified dsDNA viruses.
Sequence
MYPVLSTIFSFYGGYNYCNRQVCREFRCMIKTKPDAYLYYLDDLCRDGLINRFPRFTSSE
KIAKLALDKGLYYLLVSYKKHIPSNVVDVATRQGNLKILKWVEKNEYEIGDDCFRWAVKK
GHYHILDWLSELEYEGPEDLFYIAAEEGNVQMLDYLDKEGYYKEDEESICEVAAKKGHIC
VLEWYLEKDWSWSSHLCSLAAKGGQIETLKWLRGKGFPWNEETCVEAVKEENLELLQWLN
KEACPWNEEVCSSAVEKGYFKILNWARENGCPWNEEVCEILAYKGNLEMLQQVVDEGCPL
TENVFTAAAQGGYVEVLEWLKRVGCPLDREDFFRAARNKKSTAFWERRNLTPY
Download sequence
Identical sequences A0A285PX08

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]